PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.A02201.1.p
Common NameEUGRSUZ_A02201, LOC104443834
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family G2-like
Protein Properties Length: 310aa    MW: 32763.8 Da    PI: 9.8315
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.A02201.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like96.71.8e-30120173155
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       +prl+Wtp+LH+rFv+av++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  Eucgr.A02201.1.p 120 RPRLVWTPQLHKRFVDAVAHL-GIKNAVPKTIMQLMSVDGLTRENVASHLQKYRL 173
                       59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.24E-20117177IPR009057Homeodomain-like
PROSITE profilePS5129410.56117176IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-30119178IPR009057Homeodomain-like
TIGRFAMsTIGR015573.3E-24121173IPR006447Myb domain, plants
PfamPF002491.2E-7123172IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MREDDGGNWF TKWQVELPPP EELTPLTQSL ITPDLALAFD IGRGPSSSNN SISVVGAKQR  60
HLLPSPPPLP QQLSSSTRDS KTGAPAARQP GPVDFADSGD LGSGGGAGGG GDEPARTLKR  120
PRLVWTPQLH KRFVDAVAHL GIKNAVPKTI MQLMSVDGLT RENVASHLQK YRLYLRRMQG  180
LSGGGGGSSS ADAATERLFA SAPVPPHFLH PGRPSSDHFL ALQHHQHLAA EAAAAAAIPQ  240
YRRQVGHFGL PPNGQFEHPL LQSRQGQIAH SMGAAMSMHN PIQSSVGESD SVKGSGGRKV  300
LTLFPTGDD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A8e-21119178463ARR10-B
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.A02201.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010055683.10.0PREDICTED: transcription factor PCL1-like
SwissprotQ9SNB42e-50PCL1_ARATH; Transcription factor LUX
TrEMBLA0A059DHZ70.0A0A059DHZ7_EUCGR; Uncharacterized protein
STRINGSolyc10g080960.1.17e-98(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15492791
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10760.12e-70G2-like family protein